CDKAL1 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2083557
Artikelname: |
CDKAL1 Antibody - N-terminal region : FITC, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2083557 |
Hersteller Artikelnummer: |
orb2083557 |
Alternativnummer: |
BYT-ORB2083557-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDKAL1 |
Konjugation: |
FITC |
Alternative Synonym: |
CDKAL1, |
CDKAL1 Antibody - N-terminal region : FITC |
Klonalität: |
Polyclonal |
Molekulargewicht: |
63kDa |
UniProt: |
Q5VV42 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: QEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWI |