CDKAL1 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083558
Artikelname: CDKAL1 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083558
Hersteller Artikelnummer: orb2083558
Alternativnummer: BYT-ORB2083558-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDKAL1
Konjugation: Biotin
Alternative Synonym: CDKAL1,
CDKAL1 Antibody - N-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 63kDa
UniProt: Q5VV42
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWI