CD63 Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083563
Artikelname: CD63 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083563
Hersteller Artikelnummer: orb2083563
Alternativnummer: BYT-ORB2083563-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CD63
Konjugation: FITC
Alternative Synonym: MLA1, ME491, LAMP-3, OMA81H, TSPAN30
CD63 Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 001771
UniProt: P08962
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAA