CALCOCO2 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2083569
Artikelname: |
CALCOCO2 Antibody - C-terminal region : FITC, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2083569 |
Hersteller Artikelnummer: |
orb2083569 |
Alternativnummer: |
BYT-ORB2083569-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CALCOCO2 |
Konjugation: |
FITC |
Alternative Synonym: |
NDP52 |
CALCOCO2 Antibody - C-terminal region : FITC |
Klonalität: |
Polyclonal |
Molekulargewicht: |
44kDa |
UniProt: |
Q13137 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: SRLLSYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPL |