BRSK2 Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2083571
| Artikelname: |
BRSK2 Antibody - middle region : HRP, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2083571 |
| Hersteller Artikelnummer: |
orb2083571 |
| Alternativnummer: |
BYT-ORB2083571-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human BRSK2 |
| Konjugation: |
HRP |
| Alternative Synonym: |
SAD1, SADA, STK29, PEN11B, C11orf7 |
| BRSK2 Antibody - middle region : HRP |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
84kDa |
| UniProt: |
Q8IWQ3 |
| Puffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Formulierung: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequenz: |
Synthetic peptide located within the following region: EEENQEKMIYFLLLDRKERYPSQEDEDLPPRNEIDPPRKRVDSPMLNRHG |
