BMPR1A Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2083575
Artikelname: |
BMPR1A Antibody - N-terminal region : FITC, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2083575 |
Hersteller Artikelnummer: |
orb2083575 |
Alternativnummer: |
BYT-ORB2083575-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human BMPR1A |
Konjugation: |
FITC |
Alternative Synonym: |
ALK3, SKR5, CD292, ACVRLK3, 10q23del |
BMPR1A Antibody - N-terminal region : FITC |
Klonalität: |
Polyclonal |
Molekulargewicht: |
58kDa |
NCBI: |
005270121 |
UniProt: |
P36894 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: GMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCF |