BLK Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083578
Artikelname: BLK Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083578
Hersteller Artikelnummer: orb2083578
Alternativnummer: BYT-ORB2083578-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human BLK
Konjugation: FITC
Alternative Synonym: MODY11
BLK Antibody - N-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 001706
UniProt: P51451
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPP