BLK Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083579
Artikelname: BLK Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083579
Hersteller Artikelnummer: orb2083579
Alternativnummer: BYT-ORB2083579-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human BLK
Konjugation: Biotin
Alternative Synonym: MODY11
BLK Antibody - N-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 001706
UniProt: P51451
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPP