BICD1 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083584
Artikelname: BICD1 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083584
Hersteller Artikelnummer: orb2083584
Alternativnummer: BYT-ORB2083584-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human BICD1
Konjugation: FITC
Alternative Synonym: BICD, bic-D 1
BICD1 Antibody - N-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 91kDa
UniProt: Q96G01
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LKFAEDGSEPNNDDKMNGHIHGPLVKLNGDYRTPTLRKGESLNPVSDLFS