BATF Antibody - N-terminal : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2083588
Artikelname: |
BATF Antibody - N-terminal : Biotin, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2083588 |
Hersteller Artikelnummer: |
orb2083588 |
Alternativnummer: |
BYT-ORB2083588-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat BATF |
Konjugation: |
Biotin |
Alternative Synonym: |
B-ATF |
BATF Antibody - N-terminal : Biotin |
Klonalität: |
Polyclonal |
Molekulargewicht: |
13 kDa |
NCBI: |
008762980 |
UniProt: |
D4A7E1 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQK |