ATP6V0A4 Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083593
Artikelname: ATP6V0A4 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083593
Hersteller Artikelnummer: orb2083593
Alternativnummer: BYT-ORB2083593-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ATP6V0A4
Konjugation: FITC
Alternative Synonym: A4, STV1, VPH1, VPP2, DRTA3, RTA1C, RTADR, ATP6N2, RDRTA2, ATP6N1B
ATP6V0A4 Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 82kDa
UniProt: Q9HBG4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ADATRIKRALEQGMELSGSSMAPIMTTVQSKTAPPTFNRTNKFTAGFQNI