ATP6V0A4 Antibody - middle region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083594
Artikelname: ATP6V0A4 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083594
Hersteller Artikelnummer: orb2083594
Alternativnummer: BYT-ORB2083594-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ATP6V0A4
Konjugation: Biotin
Alternative Synonym: A4, STV1, VPH1, VPP2, DRTA3, RTA1C, RTADR, ATP6N2, RDRTA2, ATP6N1B
ATP6V0A4 Antibody - middle region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 82kDa
UniProt: Q9HBG4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ADATRIKRALEQGMELSGSSMAPIMTTVQSKTAPPTFNRTNKFTAGFQNI