ATP6V0A2 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2083595
| Artikelname: |
ATP6V0A2 Antibody - N-terminal region : HRP, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2083595 |
| Hersteller Artikelnummer: |
orb2083595 |
| Alternativnummer: |
BYT-ORB2083595-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ATP6V0A2 |
| Konjugation: |
HRP |
| Alternative Synonym: |
A2, RTF, TJ6, WSS, a2V, ARCL, J6B7, STV1, TJ6M, TJ6S, VPH1, ARCL2A, ATP6A2, ATP6N1D |
| ATP6V0A2 Antibody - N-terminal region : HRP |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
94kDa |
| NCBI: |
036595 |
| UniProt: |
Q9Y487 |
| Puffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Formulierung: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequenz: |
Synthetic peptide located within the following region: VKKICDCYHCHVYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQV |
