ATP6V0A2 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2083596
Artikelname: |
ATP6V0A2 Antibody - N-terminal region : FITC, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2083596 |
Hersteller Artikelnummer: |
orb2083596 |
Alternativnummer: |
BYT-ORB2083596-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ATP6V0A2 |
Konjugation: |
FITC |
Alternative Synonym: |
A2, RTF, TJ6, WSS, a2V, ARCL, J6B7, STV1, TJ6M, TJ6S, VPH1, ARCL2A, ATP6A2, ATP6N1D |
ATP6V0A2 Antibody - N-terminal region : FITC |
Klonalität: |
Polyclonal |
Molekulargewicht: |
94kDa |
NCBI: |
036595 |
UniProt: |
Q9Y487 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: VKKICDCYHCHVYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQV |