ATP6V0A2 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083596
Artikelname: ATP6V0A2 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083596
Hersteller Artikelnummer: orb2083596
Alternativnummer: BYT-ORB2083596-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ATP6V0A2
Konjugation: FITC
Alternative Synonym: A2, RTF, TJ6, WSS, a2V, ARCL, J6B7, STV1, TJ6M, TJ6S, VPH1, ARCL2A, ATP6A2, ATP6N1D
ATP6V0A2 Antibody - N-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 94kDa
NCBI: 036595
UniProt: Q9Y487
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VKKICDCYHCHVYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQV