ATP5F1D Antibody - middle region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083598
Artikelname: ATP5F1D Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083598
Hersteller Artikelnummer: orb2083598
Alternativnummer: BYT-ORB2083598-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ATP5D
Konjugation: HRP
Alternative Synonym: ATP5D, MC5DN5
ATP5F1D Antibody - middle region : HRP
Klonalität: Polyclonal
Molekulargewicht: 18kDa
NCBI: 001678
UniProt: P30049
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: RPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAA