Arfrp1 Antibody - N-terminal : HRP, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2083601
| Artikelname: |
Arfrp1 Antibody - N-terminal : HRP, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2083601 |
| Hersteller Artikelnummer: |
orb2083601 |
| Alternativnummer: |
BYT-ORB2083601-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen for Anti-Arfrp1 antibody is: synthetic peptide directed towards the N-terminal of Rat ARFRP |
| Konjugation: |
HRP |
| Arfrp1 Antibody - N-terminal : HRP |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
22 kDa |
| NCBI: |
006235780 |
| UniProt: |
Q63055 |
| Puffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Formulierung: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequenz: |
Synthetic peptide located within the following region: TLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSK |
