APLP2 Antibody - middle region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083604
Artikelname: APLP2 Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083604
Hersteller Artikelnummer: orb2083604
Alternativnummer: BYT-ORB2083604-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human APLP2
Konjugation: HRP
Alternative Synonym: APPH, APPL2, CDEBP, APLP-2
APLP2 Antibody - middle region : HRP
Klonalität: Polyclonal
Molekulargewicht: 83kDa
UniProt: Q06481
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: DEEEGEEVVEDRDYYYDTFKGDDYNEENPTEPGSDGTMSDKEITHDVKAV