AP2M1 Antibody - Middle region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2083609
| Artikelname: |
AP2M1 Antibody - Middle region : Biotin, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2083609 |
| Hersteller Artikelnummer: |
orb2083609 |
| Alternativnummer: |
BYT-ORB2083609-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the Middle region of Rat AP2M1 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
mu2, Ap50, Clapm1 |
| AP2M1 Antibody - Middle region : Biotin |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
47 kDa |
| NCBI: |
446289 |
| UniProt: |
P84092 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: YLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRL |
