ANKRD17 Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083610
Artikelname: ANKRD17 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083610
Hersteller Artikelnummer: orb2083610
Alternativnummer: BYT-ORB2083610-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANKRD17
Konjugation: HRP
Alternative Synonym: GTAR, MASK2, NY-BR-16
ANKRD17 Antibody - N-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 82kDa
UniProt: O75179
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: PRGMVRVCDLLLKKKPPQQQHHKAKRNRTCRPPSSSESSSDSDNSGGGGG