AFF4 Antibody - middle region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083616
Artikelname: AFF4 Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083616
Hersteller Artikelnummer: orb2083616
Alternativnummer: BYT-ORB2083616-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human AFF4
Konjugation: HRP
Alternative Synonym: MCEF, CHOPS, AF5Q31
AFF4 Antibody - middle region : HRP
Klonalität: Polyclonal
Molekulargewicht: 38kDa
UniProt: Q9UHB7
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: SSGTNSSGQRHDRESYNNSGSSSRKKGQHGSEHSKSRSSSPGKPQAVSSL