AFF4 Antibody - middle region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083618
Artikelname: AFF4 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083618
Hersteller Artikelnummer: orb2083618
Alternativnummer: BYT-ORB2083618-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human AFF4
Konjugation: Biotin
Alternative Synonym: MCEF, CHOPS, AF5Q31
AFF4 Antibody - middle region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 38kDa
UniProt: Q9UHB7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SSGTNSSGQRHDRESYNNSGSSSRKKGQHGSEHSKSRSSSPGKPQAVSSL