ACOX2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083624
Artikelname: ACOX2 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083624
Hersteller Artikelnummer: orb2083624
Alternativnummer: BYT-ORB2083624-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACOX2
Konjugation: Biotin
Alternative Synonym: BCOX, BRCOX, CBAS6, THCCox, BRCACOX
ACOX2 Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 74kDa
NCBI: 005265562
UniProt: Q99424
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DQCLNSALGCYDGNVYERLFQWAQKSPTNTQENPAYEEYIRPLLQSWRSK