AATK Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083628
Artikelname: AATK Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083628
Hersteller Artikelnummer: orb2083628
Alternativnummer: BYT-ORB2083628-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AATK
Konjugation: HRP
Alternative Synonym: LMR1, AATYK, LMTK1, p35BP, AATYK1, PPP1R77
AATK Antibody - C-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 151kDa
UniProt: Q6ZMQ8
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: APNRPQQADGSPNGSTAEEGGGFAWDDDFPLMTAKAAFAMALDPAAPAPA