AATK Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083629
Artikelname: AATK Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083629
Hersteller Artikelnummer: orb2083629
Alternativnummer: BYT-ORB2083629-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AATK
Konjugation: FITC
Alternative Synonym: LMR1, AATYK, LMTK1, p35BP, AATYK1, PPP1R77
AATK Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 151kDa
UniProt: Q6ZMQ8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: APNRPQQADGSPNGSTAEEGGGFAWDDDFPLMTAKAAFAMALDPAAPAPA