TAOK1 Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083632
Artikelname: TAOK1 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083632
Hersteller Artikelnummer: orb2083632
Alternativnummer: BYT-ORB2083632-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TAOK1
Konjugation: FITC
Alternative Synonym: PSK2, TAO1, KFC-B, MARKK, PSK-2, hKFC-B, hTAOK1, MAP3K16
TAOK1 Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 43kDa
UniProt: Q7L7X3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQSPPQ