TAOK1 Antibody - middle region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083633
Artikelname: TAOK1 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083633
Hersteller Artikelnummer: orb2083633
Alternativnummer: BYT-ORB2083633-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TAOK1
Konjugation: Biotin
Alternative Synonym: PSK2, TAO1, KFC-B, MARKK, PSK-2, hKFC-B, hTAOK1, MAP3K16
TAOK1 Antibody - middle region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 43kDa
UniProt: Q7L7X3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQSPPQ