SDHD Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083637
Artikelname: SDHD Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083637
Hersteller Artikelnummer: orb2083637
Alternativnummer: BYT-ORB2083637-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SDHD
Konjugation: HRP
Alternative Synonym: PGL, CBT1, CWS3, PGL1, QPs3, SDH4, cybS, CII-4, MC2DN3
SDHD Antibody - N-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 002993
UniProt: O14521
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: AHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLG