SDHD Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2083638
| Artikelname: |
SDHD Antibody - N-terminal region : FITC, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2083638 |
| Hersteller Artikelnummer: |
orb2083638 |
| Alternativnummer: |
BYT-ORB2083638-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SDHD |
| Konjugation: |
FITC |
| Alternative Synonym: |
PGL, CBT1, CWS3, PGL1, QPs3, SDH4, cybS, CII-4, MC2DN3 |
| SDHD Antibody - N-terminal region : FITC |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
17kDa |
| NCBI: |
002993 |
| UniProt: |
O14521 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: AHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLG |
