NDUFA4 Antibody - middle region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083645
Artikelname: NDUFA4 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083645
Hersteller Artikelnummer: orb2083645
Alternativnummer: BYT-ORB2083645-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human NDUFA4
Konjugation: Biotin
Alternative Synonym: MLRQ, CI-9k, COXFA4, CI-MLRQ, MC4DN21
NDUFA4 Antibody - middle region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 8kDa
NCBI: 002480
UniProt: O00483
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF