MPV17 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083647
Artikelname: MPV17 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083647
Hersteller Artikelnummer: orb2083647
Alternativnummer: BYT-ORB2083647-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MPV17
Konjugation: FITC
Alternative Synonym: SYM1, CMT2EE, MTDPS6
MPV17 Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 19kDa
NCBI: 005264383
UniProt: P39210
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPA