MPDU1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2083651
| Artikelname: |
MPDU1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2083651 |
| Hersteller Artikelnummer: |
orb2083651 |
| Alternativnummer: |
BYT-ORB2083651-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MPDU1 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
SL15, CDGIF, Lec35, My008, PQLC5, PP3958, SLC66A5, HBEBP2BPA |
| MPDU1 Antibody - C-terminal region : Biotin |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
27kDa |
| NCBI: |
004861 |
| UniProt: |
O75352 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: LARIFTSIQETGDPLMAGTFVVSSLCNGLIAAQLLFYWNAKPPHKQKKAQ |
