LRCH1 Antibody - middle region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083654
Artikelname: LRCH1 Antibody - middle region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083654
Hersteller Artikelnummer: orb2083654
Alternativnummer: BYT-ORB2083654-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LRCH1
Konjugation: Biotin
Alternative Synonym: NP81, CHDC1
LRCH1 Antibody - middle region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 80kDa
NCBI: 055931
UniProt: Q9Y2L9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVPMSNIMEEEQ