IFNAR1 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083655
Artikelname: IFNAR1 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083655
Hersteller Artikelnummer: orb2083655
Alternativnummer: BYT-ORB2083655-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFNAR1
Konjugation: HRP
Alternative Synonym: AVP, IFRC, IFNAR, IFNBR, IFN-alpha-REC
IFNAR1 Antibody - C-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 000620
UniProt: P17181
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: QIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESK