IFNAR1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083657
Artikelname: IFNAR1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083657
Hersteller Artikelnummer: orb2083657
Alternativnummer: BYT-ORB2083657-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFNAR1
Konjugation: Biotin
Alternative Synonym: AVP, IFRC, IFNAR, IFNBR, IFN-alpha-REC
IFNAR1 Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 000620
UniProt: P17181
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESK