DNAJC15 Antibody - middle region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083661
Artikelname: DNAJC15 Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083661
Hersteller Artikelnummer: orb2083661
Alternativnummer: BYT-ORB2083661-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human DNAJC15
Konjugation: HRP
Alternative Synonym: MCJ, HSD18, DNAJD1
DNAJC15 Antibody - middle region : HRP
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 037370
UniProt: Q9Y5T4
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: FAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLIL