CHST10 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083665
Artikelname: CHST10 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083665
Hersteller Artikelnummer: orb2083665
Alternativnummer: BYT-ORB2083665-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CHST10
Konjugation: FITC
Alternative Synonym: HNK1ST, HNK-1ST
CHST10 Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 005264131
UniProt: O43529
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YRHEIAPGIIRKYRRNRTETRGIQFEDFVRYLGDPNHRWLDLQFGDHIIH