CDC37 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2083671
Artikelname: |
CDC37 Antibody - middle region : FITC, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2083671 |
Hersteller Artikelnummer: |
orb2083671 |
Alternativnummer: |
BYT-ORB2083671-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human CDC37 |
Konjugation: |
FITC |
Alternative Synonym: |
P50CDC37 |
CDC37 Antibody - middle region : FITC |
Klonalität: |
Polyclonal |
Molekulargewicht: |
41kDa |
NCBI: |
008996 |
UniProt: |
Q16543 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: KTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCE |