CDC37 Antibody - middle region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083671
Artikelname: CDC37 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083671
Hersteller Artikelnummer: orb2083671
Alternativnummer: BYT-ORB2083671-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CDC37
Konjugation: FITC
Alternative Synonym: P50CDC37
CDC37 Antibody - middle region : FITC
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 008996
UniProt: Q16543
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCE