ZSWIM9 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083677
Artikelname: ZSWIM9 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083677
Hersteller Artikelnummer: orb2083677
Alternativnummer: BYT-ORB2083677-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human C19orf68
Konjugation: FITC
Alternative Synonym: C19orf68
ZSWIM9 Antibody - C-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 68kDa
UniProt: Q86XI8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GEKGRALQIRDWRGGRLENQKPRGLEGGVLRGSKLEKGHLRGPEIRDWRG