ZNF846 Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083682
Artikelname: ZNF846 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083682
Hersteller Artikelnummer: orb2083682
Alternativnummer: BYT-ORB2083682-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen for Anti-ZNF846 antibody is: synthetic peptide directed towards the N-terminal region of Human ZN846
Konjugation: HRP
ZNF846 Antibody - N-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 23 kDa
UniProt: Q147U1
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: MTHMITHIGEKTSEDNQSGKALRKNFPHSFYKKSHAEGKMPKCVKHEKAF