FAM118B Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2083693
Artikelname: |
FAM118B Antibody - N-terminal region : Biotin, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2083693 |
Hersteller Artikelnummer: |
orb2083693 |
Alternativnummer: |
BYT-ORB2083693-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of human FAM118B |
Konjugation: |
Biotin |
FAM118B Antibody - N-terminal region : Biotin |
Klonalität: |
Polyclonal |
Molekulargewicht: |
30kDa |
NCBI: |
078832 |
UniProt: |
Q9BPY3 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequenz: |
Synthetic peptide located within the following region: IFGFFNDGEPPTKKPRKLLPSLKTKKPRELVLVIGTGISAAVAPQVPALK |