DCAF16 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083695
Artikelname: DCAF16 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083695
Hersteller Artikelnummer: orb2083695
Alternativnummer: BYT-ORB2083695-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DCAF16
Konjugation: FITC
Alternative Synonym: C4orf30
DCAF16 Antibody - N-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 005248228
UniProt: Q9NXF7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SEEEENISYLNESSGEEWDSSEEEDSMVPNLSPLESLAWQVKCLLKYSTT