UBXN8 Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2083697
Artikelname: |
UBXN8 Antibody - middle region : HRP, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2083697 |
Hersteller Artikelnummer: |
orb2083697 |
Alternativnummer: |
BYT-ORB2083697-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human UBXN8 |
Konjugation: |
HRP |
Alternative Synonym: |
REP8, UBXD6, D8S2298E |
UBXN8 Antibody - middle region : HRP |
Klonalität: |
Polyclonal |
Molekulargewicht: |
29kDa |
NCBI: |
005662 |
UniProt: |
O00124 |
Puffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Formulierung: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Sequenz: |
Synthetic peptide located within the following region: RKLEERFYQMTGEAWKLSSGHKLGGDEGTSQTSFETSNREAAKSQNLPKP |