UBXN8 Antibody - middle region : FITC, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2083698
| Artikelname: |
UBXN8 Antibody - middle region : FITC, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2083698 |
| Hersteller Artikelnummer: |
orb2083698 |
| Alternativnummer: |
BYT-ORB2083698-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human UBXN8 |
| Konjugation: |
FITC |
| Alternative Synonym: |
REP8, UBXD6, D8S2298E |
| UBXN8 Antibody - middle region : FITC |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
29kDa |
| NCBI: |
005662 |
| UniProt: |
O00124 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: RKLEERFYQMTGEAWKLSSGHKLGGDEGTSQTSFETSNREAAKSQNLPKP |
