INTS9 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083711
Artikelname: INTS9 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083711
Hersteller Artikelnummer: orb2083711
Alternativnummer: BYT-ORB2083711-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human INTS9
Konjugation: Biotin
Alternative Synonym: INT9, RC74, CPSF2L
INTS9 Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 69kDa
NCBI: 005273622
UniProt: Q9NV88
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDD