CCDC82 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2083717
Artikelname: CCDC82 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2083717
Hersteller Artikelnummer: orb2083717
Alternativnummer: BYT-ORB2083717-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC82
Konjugation: Biotin
Alternative Synonym: HSPC048
CCDC82 Antibody - C-terminal region : Biotin
Klonalität: Polyclonal
Molekulargewicht: 37kDa
UniProt: Q8N4S0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SSDEVDEEEEEDNYESDEDGDDYIIDDFVVQDEEGDEENKNQQGEKLTTS