CDK17 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2083726
| Artikelname: |
CDK17 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2083726 |
| Hersteller Artikelnummer: |
orb2083726 |
| Alternativnummer: |
BYT-ORB2083726-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDK17 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
PCTK2, PCTAIRE2 |
| CDK17 Antibody - C-terminal region : Biotin |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
57kDa |
| NCBI: |
002586 |
| UniProt: |
Q00537 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: RSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF |
