JOSD1 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086146
Artikelname: JOSD1 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086146
Hersteller Artikelnummer: orb2086146
Alternativnummer: BYT-ORB2086146-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human JOSD1
Konjugation: FITC
Alternative Synonym: dJ508I15.2
JOSD1 Antibody - N-terminal region : FITC
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 055691
UniProt: Q15040
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: DKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQE