JOSD1 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2086148
Artikelname: |
JOSD1 Antibody - N-terminal region : HRP, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2086148 |
Hersteller Artikelnummer: |
orb2086148 |
Alternativnummer: |
BYT-ORB2086148-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human JOSD1 |
Konjugation: |
HRP |
Alternative Synonym: |
dJ508I15.2 |
JOSD1 Antibody - N-terminal region : HRP |
Klonalität: |
Polyclonal |
Molekulargewicht: |
23kDa |
NCBI: |
055691 |
UniProt: |
Q15040 |
Puffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Formulierung: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Sequenz: |
Synthetic peptide located within the following region: SCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAF |