IQCC Antibody - middle region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086163
Artikelname: IQCC Antibody - middle region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086163
Hersteller Artikelnummer: orb2086163
Alternativnummer: BYT-ORB2086163-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human IQCC
Konjugation: HRP
Alternative Synonym: RP4-622L5.6
IQCC Antibody - middle region : HRP
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 001153514
UniProt: F5H7T8
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: ANQGSLCRDHSSWLQMKQNRKPSQEKTRDTTRMENPEATDQRLPHSQPQL