INTS10 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2086172
Artikelname: INTS10 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2086172
Hersteller Artikelnummer: orb2086172
Alternativnummer: BYT-ORB2086172-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human INTS10
Konjugation: HRP
Alternative Synonym: INT10, C8orf35
INTS10 Antibody - C-terminal region : HRP
Klonalität: Polyclonal
Molekulargewicht: 82kDa
NCBI: 060612
UniProt: Q9NVR2
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: MVLPIQDGGKSQEEPSKVKPKFRKGSDLKLLPCTSKAIMPYCLHLMLACF